<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27986
| Description |
Uncharacterized protein |
| Sequence | MLDWLYYAPVVGARVPDVDPSSLTASLVSLGAISSQRKHWQFTREQLEDLRSKLEDEDQALVQAYPLPQLRHLSIYFNQQMTRLGKRLGVRQQAMATAQLYIRRFYSKVEIRKTNPYLVLATAVYLACKMEECPHHIRLVVSEGRGLWPEYFSNDTSRLGECEFFLISEMSSQMIKNPILLGLL |
| Length | 184 |
| Position | Kinase |
| Organism | Botryotinia fuckeliana (strain T4) (Noble rot fungus) (Botrytis cinerea) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Sclerotiniaceae> Botrytis.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.174 |
| Instability index | 60.12 |
| Isoelectric point | 8.43 |
| Molecular weight | 21240.35 |
| Publications | PubMed=21876677
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27986
No repeats found
|