<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27979
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MASQDPPLDEIQWRDPNWLAGNSGLHENTVLHYFAQSPFFDLTSNNSVLTSQAMHNQNMSYILATRSAFEGRLKTMSGLEFLIAQEPAEMAPGTGTGVWVISKQTRRKRAQEEDEIIKHASYFVVGENIYMAPTVADVLGSRMLSIFTSLTNAISKVSELPNFSPSLGHTYMPPVPPRSKTITSAFSQASKENTPLPDPLATEAKNPSTNASNNVLANHLLEETLNISLRYGDEYMDENPITGTPGDFHFSTTGRKEKEKLMVPPTSKPAGFGLSGKPAPPTPLKTDLGMQKKGNKGEKSPRTPGSGKPKRRKSKVLNGGPST |
| Length | 323 |
| Position | Head |
| Organism | Botryotinia fuckeliana (strain T4) (Noble rot fungus) (Botrytis cinerea) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Helotiales> Sclerotiniaceae> Botrytis.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.585 |
| Instability index | 52.80 |
| Isoelectric point | 9.06 |
| Molecular weight | 35214.39 |
| Publications | PubMed=21876677
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27979
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.42| 18| 22| 163| 180| 1
---------------------------------------------------------------------------
163- 180 (37.68/17.89) FS.PSLGHTYMP.PVPPRSK
186- 205 (19.74/ 6.46) FSqASKENTPLPdPLATEAK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 127.23| 39| 209| 63| 108| 2
---------------------------------------------------------------------------
63- 108 (60.46/44.21) LATRSAFEGRLKTMSGLEFLIAQ.EPAEMAPGTGtgvwvisKQTRRK
274- 313 (66.77/35.15) LSGKPAPPTPLKTDLGMQKKGNKgEKSPRTPGSG.......KPKRRK
---------------------------------------------------------------------------
|