Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MSSSPEENQTSAFRPFTKAERIQQLNEIDKSILQLVQTAGQTLKILTAAQEPGESQSPQEKRQAFEDASNSYLKTLQSVDVRLRRQILGLEEAEIIPAEKVKSKNKGKSVAEVVERRSAVPGNMAGNMPADDIVVEGGMGNLDIGFLNSRSGRVGRDMEAELWAKSRKFLEDLDKGNYNSRPLTQMRDEVEK |
Length | 192 |
Position | Head |
Organism | Botryotinia fuckeliana (strain T4) (Noble rot fungus) (Botrytis cinerea) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Helotiales> Sclerotiniaceae> Botrytis. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.724 |
Instability index | 64.95 |
Isoelectric point | 5.49 |
Molecular weight | 21365.80 |
Publications | PubMed=21876677 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP27976 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.62| 22| 30| 139| 161| 1 --------------------------------------------------------------------------- 139- 161 (35.42/31.20) MGNLDIGFLNSRSGRVGRDmEAE 170- 191 (40.20/29.51) LEDLDKGNYNSRPLTQMRD.EVE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 78.46| 25| 31| 77| 101| 2 --------------------------------------------------------------------------- 77- 101 (40.01/31.53) QSV.DVRLRRQILGLEEAEIIPAEKV 108- 133 (38.46/30.03) KSVaEVVERRSAVPGNMAGNMPADDI --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
NA | NA | NA |
MoRF Sequence | Start | Stop |
1) IGFLNSRSGRVGRDMEAELWAKSRKFLEDLDK 2) QTSAFRPFTKAERIQ | 144 9 | 175 23 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab