Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSFHPQTPQSPSQLSPGTSDLASSMNSSLTSLTTLPTPAHSVNGSTSHLPDTSHDYAMGDDTPQKRKRSIGDVGERDQKKPHVEDGKLDIDDLHQDVGEKYLLCQTPHRTQEFPCITEDLFEMFGLTEIAAEVAREKSNGDKTIKNGLRKTYKGHIKRLGIMGRFDSVAQEWEEPEEVDDDGDQDEDDRPTQKKEKSNEPYFGFGKIMNLSDPEFWHGRSYLMQGLTPRARAELPKALAMAKGQIPEGFDASVLNDDGSRPAAAARSAAPGTPIGTPGSNMGQLKQAQGIPRPQRVNKKRGYGDNSFEGYEGYEDGYATGDGDDRGGQKRRKKAVGTPQFQNGTPRPSYGSGIGV |
Length | 355 |
Position | Head |
Organism | Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.994 |
Instability index | 39.24 |
Isoelectric point | 5.57 |
Molecular weight | 38841.35 |
Publications | PubMed=21829347 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP27973 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 186.28| 49| 62| 224| 273| 1 --------------------------------------------------------------------------- 175- 203 (30.78/11.07) .......................PEEVDDDGDQDED.DRPTqKKEKSNEPYFG 224- 273 (78.39/43.13) QGLtPR.ARAELPKALAMAKGQIPEGFDASVLNDDG.SRPA.AAARSAAPGTP 288- 338 (77.12/38.77) QGI.PRpQRVNKKRGYGDNSFEGYEGYEDGYATGDGdDRGG.QKRRKKAVGTP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 38.90| 11| 23| 72| 82| 2 --------------------------------------------------------------------------- 72- 82 (21.80/12.45) DVGERDQ..KKPH 96- 108 (17.10/ 8.39) DVGEKYLlcQTPH --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EGYEGYEDGYATGD 2) GQKRRKKAVGTPQFQNGT 3) PYFGFGKI | 308 327 200 | 321 344 207 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab