<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27969
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MAPVENNPQELLEQQLKDTIQDLYQIMLQITMYTTTPTHSSHTALTSSLQTLSASLQAVHTTAVAGAPPTPDGVPPNAQDQLGMPPGVPLHDPARHVTPGALPNIPPELVQYVENGRNPDIYTREFVELVRRGNQLMRGKMGAFAQLRDVLAGEMRSAMPEVAEDVARVVEMTSPVKREGA |
| Length | 181 |
| Position | Middle |
| Organism | Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.343 |
| Instability index | 51.49 |
| Isoelectric point | 5.14 |
| Molecular weight | 19682.17 |
| Publications | PubMed=21829347
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27969
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 66.48| 14| 15| 103| 116| 1
---------------------------------------------------------------------------
86- 100 (21.78/10.42) PGV.PlHDPARHVTPG
103- 116 (25.82/13.42) PNI.P.PELVQYVENG
119- 133 (18.89/ 8.28) PDIyT.REFVELVRRG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.16| 12| 15| 137| 150| 2
---------------------------------------------------------------------------
137- 150 (18.09/15.74) MRGKMGAFAQlrDV
155- 166 (22.07/12.34) MRSAMPEVAE..DV
---------------------------------------------------------------------------
|