| Description | Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | METKSEEKDVPMTNLPPAAPAGADDNEPVYGGFTRFEIELEFVQSLANPAYLNHLAAQKLLSKPEFVAYLAYLQYWSKPPYLKYLMYPGPTLKHLELLQQPQFRQDIISPDLVQRLVDDGMRAAVEWHHDDK |
| Length | 132 |
| Position | Middle |
| Organism | Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium. |
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.467 |
| Instability index | 45.19 |
| Isoelectric point | 4.96 |
| Molecular weight | 15161.08 |
| Publications | PubMed=21829347 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP27961
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.95| 15| 21| 41| 61| 1
---------------------------------------------------------------------------
41- 55 (28.86/22.03) EFVQSLA......NPAYLNHL
65- 85 (23.09/ 6.52) EFVAYLAylqywsKPPYLKYL
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) GFTRF 2) PYLKYLMYP | 32 80 | 36 88 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab