<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27961
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | METKSEEKDVPMTNLPPAAPAGADDNEPVYGGFTRFEIELEFVQSLANPAYLNHLAAQKLLSKPEFVAYLAYLQYWSKPPYLKYLMYPGPTLKHLELLQQPQFRQDIISPDLVQRLVDDGMRAAVEWHHDDK |
| Length | 132 |
| Position | Middle |
| Organism | Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.467 |
| Instability index | 45.19 |
| Isoelectric point | 4.96 |
| Molecular weight | 15161.08 |
| Publications | PubMed=21829347
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27961
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.95| 15| 21| 41| 61| 1
---------------------------------------------------------------------------
41- 55 (28.86/22.03) EFVQSLA......NPAYLNHL
65- 85 (23.09/ 6.52) EFVAYLAylqywsKPPYLKYL
---------------------------------------------------------------------------
|