Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MAYRQQTNALGLSDDETKALEQTRQRLYQLTNSIQSFKADVAKSNPLPPQSSLQAQYQILLRNLQSLLDIVNENAVPFAHTSVHPAVNFPGRTQENILLTLLRKKREPDVEERVERGLETARDVRAAVAADGKDGITRLEEVWKELRAWTQERVAQYVIEEAGDVYTREEREGGIENVRSGLKRPLEEPDESDDEDGDDDENEEEDVVMGDGAQSGAPQPGKVAGPEPEVFFWFSARGDFDLPRNVEFEKDAAKRARLAVAGGPPRIS |
Length | 268 |
Position | Head |
Organism | Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.780 |
Instability index | 52.52 |
Isoelectric point | 4.66 |
Molecular weight | 29996.75 |
Publications | PubMed=21829347 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP27958 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 4| 148.38| 38| 78| 95| 132| 1 --------------------------------------------------------------------------- 95- 128 (44.65/21.29) .......................ENILLTLLRKKREPDVEERVER..GLETARDVRAAV 129- 180 (23.44/ 8.19) AADGkdgitrleevwkelrawtqERVAQYVI..EEAGDVYTREERegGIENVRS..... 182- 208 (31.99/13.47) .............................LKRPLEEPD.ESDDED..GDDDENEEEDVV 209- 260 (48.30/23.54) MGDG.....aqsgapqpgkvagpEPEVFFWFSARGDFDLPRNVEF..EKDAAKRARLAV --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) NEEEDVVMGDGAQ 2) QPGKVAGPEPEVFFWFSARGDFDLPRNVEFEKDAAKRARLAVAGGP | 202 219 | 214 264 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab