| Description | Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MTDRLTQLQDAVDQLAQQFVACFHYVNRHHDLEVLGPKDKVRDVTKGASQLEVEPADPEEFRAGLLELSRDLIVKEQQIEVLISTLPGLDTSEADQEKNVRELEEELKIAEVQRQEAIKEKDQILVKLDEVIRNVRRP |
| Length | 138 |
| Position | Middle |
| Organism | Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137) (Verticillium wilt) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Glomerellales> Plectosphaerellaceae> Verticillium. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.586 |
| Instability index | 45.74 |
| Isoelectric point | 4.74 |
| Molecular weight | 15879.76 |
| Publications | PubMed=21829347 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:UniProtKB-UniRule |
| GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi transcription coactivator activity GO:0003713 IEA:EnsemblFungi transcription corepressor activity GO:0003714 IEA:EnsemblFungi |
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
| Binary Interactions |
| Repeats |
>MDP27957
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.37| 20| 22| 93| 114| 1
---------------------------------------------------------------------------
93- 114 (27.86/19.97) EADQEKN..VRELEEelKIAEVQR
116- 137 (27.51/14.06) EAIKEKDqiLVKLDE..VIRNVRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.99| 12| 26| 42| 53| 2
---------------------------------------------------------------------------
42- 53 (19.50/10.66) RDVTKGASQLEV
70- 81 (19.49/10.66) RDLIVKEQQIEV
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DQEKNVREL 2) GLLELS | 95 64 | 103 69 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab