<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27956
| Description |
Uncharacterized protein |
| Sequence | MAANYWESTQRKHWQFTKDELAALRQRLDDEDPGLVHMFPLPQLRHLNIYFNQQINRLGKRLGVRQQAMATAQVYLKRFYTRTPIRQTNPYLVLTTALYLACKMEECPQHIRLLSQEARSLWPSDMHGHDASRVGECEFSLISEMNSQLIVHQPYRTLLALQDTFALTHDETSLAWMIINDHYMTDLPLLHPPHVVALTAVLLALVLRPSSNPSGAGGAGAGGGAATAAAAAGATGAAGGVAMAATALAQAQAQAQARAAAATSAGGSGAATQPGFSSQGSQQAQTAGFSQGGSQGDGQQAAEPKKATDPRLAKVQRFAAWLADSSIDIEAMVDCTQELISFYECHEQYNDKHTREQISRFIKARGLDK |
| Length | 369 |
| Position | Kinase |
| Organism | Thielavia terrestris (strain ATCC 38088 / NRRL 8126) (Acremonium alabamense) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Chaetomiaceae> Thermothielavioides>
Thermothielavioides terrestris.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.292 |
| Instability index | 50.38 |
| Isoelectric point | 6.89 |
| Molecular weight | 40069.78 |
| Publications | PubMed=21964414
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27956
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.58| 20| 25| 216| 240| 1
---------------------------------------------------------------------------
216- 235 (35.41/12.69) AGGAGAGGGAATAAAAAGAT
244- 263 (31.17/17.13) AATALAQAQAQAQARAAAAT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.73| 23| 25| 139| 161| 2
---------------------------------------------------------------------------
139- 161 (39.62/27.04) FSLISEMNS..QLIVHQPYRTLLAL
165- 189 (39.11/26.61) FALTHDETSlaWMIINDHYMTDLPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.45| 10| 25| 264| 273| 3
---------------------------------------------------------------------------
264- 273 (18.55/ 8.73) SAGGS.GAATQ
290- 300 (15.90/ 6.61) SQGGSqGDGQQ
---------------------------------------------------------------------------
|