Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MASLNMAPEELKQLELLRNRYAQLTSSLASLRAGIINSNPLPSRESLQASATILQQNIRTLQELATENADLFQRTAVHPSTNFPGRTQEHVLLQLVRKKLEPDVESWVEEARETAAAAGVDATKLATGVPTRREHDYDEDIYGMDQDEDVSSDPFTDQWADMHDAFQETLQHYVTVQVKKKYTIEEQAMGIENVRTGLRQNLEESDEEEDEEEEEEEEDEAAGAAEHARDAGSGAGGPGAAGGKPTLEPEHLFWLAARGDLDIPRNIPFVSQR |
Length | 273 |
Position | Head |
Organism | Thielavia terrestris (strain ATCC 38088 / NRRL 8126) (Acremonium alabamense) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Sordariales> Chaetomiaceae> Thermothielavioides> Thermothielavioides terrestris. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.738 |
Instability index | 62.93 |
Isoelectric point | 4.46 |
Molecular weight | 30378.91 |
Publications | PubMed=21964414 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP27953 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 177.56| 55| 113| 101| 158| 1 --------------------------------------------------------------------------- 101- 158 (93.47/61.88) EPDVESWVEEARETAAAA........GVDATKLATGVPT.RREHDYDEDIYGmdqDEDVSSD.PFTDQ 208- 272 (84.09/48.28) EEDEEEEEEEEDEAAGAAehardagsGAGGPGAAGGKPTlEPEHLFWLAARG...DLDIPRNiPFVSQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AAEHARDAG 2) AAGGKPTLEPEHLFWLAARGDLDIPRNIPFV | 224 240 | 232 270 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab