<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27951
Description |
Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MAPINPDLQSTQEDIKNVIQDLFQILAQVANYDSTSRPSREALAQDIIALSSSLAQTHRAATLLGPARADKAVPEPLVQYVENGRNPDIYTREFVELVRRMNQLARGKMHAFRAFRDVLAAEIALQMPEVDADVRRVLEGTGGGGGSSNDGGGEQEGAAAGGGGGGGGGVEVVKQQQQQQ |
Length | 180 |
Position | Middle |
Organism | Thielavia terrestris (strain ATCC 38088 / NRRL 8126) (Acremonium alabamense) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Chaetomiaceae> Thermothielavioides>
Thermothielavioides terrestris.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.419 |
Instability index | 62.29 |
Isoelectric point | 4.95 |
Molecular weight | 19094.02 |
Publications | PubMed=21964414
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP27951
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 112.88| 38| 78| 5| 47| 1
---------------------------------------------------------------------------
5- 47 (46.72/41.87) NPDLQsTQEDIKnVIQDLFQiLAQVANYdsTSRPSREALAQDI
86- 123 (66.17/37.15) NPDIY.TREFVE.LVRRMNQ.LARGKMH..AFRAFRDVLAAEI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.10| 16| 16| 139| 154| 2
---------------------------------------------------------------------------
139- 154 (32.02/16.34) EGTGGGGGSSNDGGGE
156- 171 (31.09/15.67) EGAAAGGGGGGGGGVE
---------------------------------------------------------------------------
|