| Description | Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MPDPEGSSSPSSPSADPVSSFKAAQSAFFNTIDRVDKHLTRQILALEEAGIVTLRSSSSSSRGGGGGGTAIGGADGPLQQGESLGMGAAAGPGQQQQQQLAQAQVGGGGGGGGEGAAGDGSKAKAAAPVARLEPDGMGRYGKLDVGKLNMASSTVERDMEEELWRRAREQLARVVSGSGAGQGQEGERMEE |
| Length | 191 |
| Position | Head |
| Organism | Thielavia terrestris (strain ATCC 38088 / NRRL 8126) (Acremonium alabamense) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Sordariales> Chaetomiaceae> Thermothielavioides> Thermothielavioides terrestris. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.581 |
| Instability index | 59.80 |
| Isoelectric point | 4.94 |
| Molecular weight | 19169.73 |
| Publications | PubMed=21964414 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP27943
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.38| 22| 69| 94| 115| 3
---------------------------------------------------------------------------
94- 115 (40.93/17.18) QQQQQQLAQAQVGGGGGGGGEG
165- 186 (38.45/15.68) RRAREQLARVVSGSGAGQGQEG
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) ELWRRAREQLARVVS 2) KAKAAAPVARLEPD 3) MGAAA 4) MGRYGKLDV 5) QLAQA | 162 122 86 137 99 | 176 135 90 145 103 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab