<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27938
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MAQNPATSAGPPLDEIQWRAPPDFEQGIHNNSVLYYFAQSPFYDKTSNNEVVFQQGLNNPNMTQFLATRELFEGRLKTMSGLEFIVAQEPAETGPGAGTGVWVINKQTRRKRQGEEDEITVHAVYFIVGENIYMAPSLWDIMSSRIASISTQVSKILPISSSVESWSAAQGRTYHQPAAPGTSSSTTTKQPDGTALPDAALPSPSVLEEALAIHTHFGDHYMNENPITGRPGDFHLSSTGRKLVSLSAPAAGNLKKGPALPALNTKVGDGGGSENPLASKPSGKETKSPKTPGGGSAMQKAKKRKGSKAVVTPQ |
Length | 314 |
Position | Head |
Organism | Thielavia terrestris (strain ATCC 38088 / NRRL 8126) (Acremonium alabamense) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Chaetomiaceae> Thermothielavioides>
Thermothielavioides terrestris.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.508 |
Instability index | 54.38 |
Isoelectric point | 8.62 |
Molecular weight | 33512.18 |
Publications | PubMed=21964414
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP27938
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.61| 14| 20| 270| 287| 1
---------------------------------------------------------------------------
270- 283 (26.74/20.59) GGGSENPLASKPSG
293- 306 (25.87/ 9.73) GGGSAMQKAKKRKG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.25| 20| 20| 161| 180| 2
---------------------------------------------------------------------------
161- 180 (35.61/19.29) SSVESWSAAQGRTYHQPAAP
183- 202 (30.63/15.70) SSSTTTKQPDGTALPDAALP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.10| 21| 28| 24| 44| 6
---------------------------------------------------------------------------
24- 44 (38.94/26.03) FEQGIHNNSVLYYFAQSPFYD
53- 73 (37.16/24.56) FQQGLNNPNMTQFLATRELFE
---------------------------------------------------------------------------
|