Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MDGLEDDPNRVTALWPDPPPFWRDFTPENIERFESLKEDYADQQGLSADAVIRIPNIPEHLINLQPPSEPADGKWRLFSEPETLTETLQSLEDAGIQRLGPTSEIDRDSKHLDRGFELKKLVKSLLLNYLELVGLMGHNPAHAAGKIEDIKVLLLNFHHTLNEYRPHHAREQLIQMMHAHGDQIRAETAGIRSVVDKAKRMIEGLASIQVPQLEKGPSEKEALEPRPEQLQEQRELAGWKRIDEEFS |
Length | 247 |
Position | Middle |
Organism | Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Sordariales> Chaetomiaceae> Thermothelomyces. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.687 |
Instability index | 52.35 |
Isoelectric point | 5.06 |
Molecular weight | 28216.48 |
Publications | PubMed=21964414 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP27933 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 61.66| 19| 21| 47| 65| 1 --------------------------------------------------------------------------- 47- 65 (31.80/19.21) SADAVIRIPNIPEHLIN.LQ 70- 89 (29.85/17.65) PADGKWRLFSEPETLTEtLQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 70.10| 20| 25| 122| 143| 2 --------------------------------------------------------------------------- 122- 143 (31.89/25.17) VKSLLLNYLElvGLMGHNPAHA 150- 169 (38.21/23.98) IKVLLLNFHH..TLNEYRPHHA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 57.38| 15| 207| 4| 18| 3 --------------------------------------------------------------------------- 4- 18 (29.96/17.26) LEDDPNRVTALWPDP 213- 227 (27.42/15.24) LEKGPSEKEALEPRP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GKWRLFS 2) PFWRDFTPENIERFE 3) RELAGWKRIDEEFS | 73 20 234 | 79 34 247 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab