<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27933
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MDGLEDDPNRVTALWPDPPPFWRDFTPENIERFESLKEDYADQQGLSADAVIRIPNIPEHLINLQPPSEPADGKWRLFSEPETLTETLQSLEDAGIQRLGPTSEIDRDSKHLDRGFELKKLVKSLLLNYLELVGLMGHNPAHAAGKIEDIKVLLLNFHHTLNEYRPHHAREQLIQMMHAHGDQIRAETAGIRSVVDKAKRMIEGLASIQVPQLEKGPSEKEALEPRPEQLQEQRELAGWKRIDEEFS |
| Length | 247 |
| Position | Middle |
| Organism | Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Chaetomiaceae> Thermothelomyces.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.687 |
| Instability index | 52.35 |
| Isoelectric point | 5.06 |
| Molecular weight | 28216.48 |
| Publications | PubMed=21964414
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27933
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.66| 19| 21| 47| 65| 1
---------------------------------------------------------------------------
47- 65 (31.80/19.21) SADAVIRIPNIPEHLIN.LQ
70- 89 (29.85/17.65) PADGKWRLFSEPETLTEtLQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.10| 20| 25| 122| 143| 2
---------------------------------------------------------------------------
122- 143 (31.89/25.17) VKSLLLNYLElvGLMGHNPAHA
150- 169 (38.21/23.98) IKVLLLNFHH..TLNEYRPHHA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.38| 15| 207| 4| 18| 3
---------------------------------------------------------------------------
4- 18 (29.96/17.26) LEDDPNRVTALWPDP
213- 227 (27.42/15.24) LEKGPSEKEALEPRP
---------------------------------------------------------------------------
|