<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27930
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MALDPAPYTGPPLDEIQWRAPPEFEMGIHSNSVLFYFAQSPFYDRTSNNEVLFQQGLNNPNVTPYLATRELFEGRLKTMSGLEFVVAQEPAETGPGAGTGVWVINKQTRRKQTPQDEIIVHGTYFVVGENIYMAASFADILSSRIVGFNCPFRIPLVPRTHRPLTISNTGSDIVFG |
| Length | 176 |
| Position | Head |
| Organism | Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Chaetomiaceae> Thermothelomyces.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.190 |
| Instability index | 49.30 |
| Isoelectric point | 5.34 |
| Molecular weight | 19608.99 |
| Publications | PubMed=21964414
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27930
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.06| 16| 16| 20| 35| 1
---------------------------------------------------------------------------
20- 35 (29.97/17.68) APPEFEMGIHSNSVLF
38- 53 (29.08/16.99) AQSPFYDRTSNNEVLF
---------------------------------------------------------------------------
|