<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27923
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MESEPMSVDSAALEPPSLPADGANEPKYGGHSRFELELEFVQSLANPQYLNYLASRKFLTNPAFVAYLDYLQYWTRPPYLKYLTFPTATLKMLELLQQEKFRQDIISPDLAHAMIMEGMKTAVEWHREG |
| Length | 129 |
| Position | Middle |
| Organism | Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) (Sporotrichum thermophile) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Chaetomiaceae> Thermothelomyces.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.370 |
| Instability index | 50.63 |
| Isoelectric point | 4.98 |
| Molecular weight | 14846.79 |
| Publications | PubMed=21964414
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27923
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 77.38| 16| 22| 57| 72| 1
---------------------------------------------------------------------------
27- 42 (26.40/14.58) KYGGHS.RFELELEFVQ
57- 72 (28.05/15.83) KFLTNP.AFVAYLDYLQ
81- 97 (22.92/11.96) KYLTFPtATLKMLELLQ
---------------------------------------------------------------------------
|