<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27904
Description |
Uncharacterized protein |
Sequence | MEDQIAKAAHISVPSAPISAMPLPPYTSKVKVLDKYHIIGFISSGTYGRVYKARSRHPGTTGEFAIKKYGSFSRLDSNVCQHALNSELAHENVIHLHEIILEDKCIYMVFEYAEHDLLQIVHHHSHPERRLIPESTIRSILWQLLNGVSYLHQNWVMHRDLKPANIMVTASGEVKIGDLGLARVFWKPLAALFNGDKVVVTIWYRAPELLLGSRHYTAAIDLWAVGCIFAELLALRPIFKGEEAKMDSKKTVPFQRNQMQKIIEILGTPTKERWPSITQLPEYPQMAPFKPYICSLETWYQQVGATNKLGYELLSGLLEFDPVKRLTAQQALEHRYFTEGPKISLNAFEGSFIEYPHRRVSSDDNDIRTSSLPGTKRSGLPDDSLQPRTKRVKAGE |
Length | 396 |
Position | Kinase |
Organism | Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491) (Nematode-trapping fungus) (Didymozoophaga oligospora) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Orbiliomycetes>
Orbiliales> Orbiliaceae> Orbilia> Arthrobotrys oligospora.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.283 |
Instability index | 46.64 |
Isoelectric point | 8.81 |
Molecular weight | 44967.23 |
Publications | PubMed=21909256
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IEA:EnsemblFungi
RNA polymerase II CTD heptapeptide repeat kinase activity GO:0008353 IEA:EnsemblFungi
|
GO - Biological Process | negative regulation of filamentous growth GO:0060258 IEA:EnsemblFungi
negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
nuclear-transcribed mRNA catabolic process, non-stop decay GO:0070481 IEA:EnsemblFungi
phosphorylation of RNA polymerase II C-terminal domain GO:0070816 IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter by galactose GO:0000435 IEA:EnsemblFungi
protein destabilization GO:0031648 IEA:EnsemblFungi
response to oxidative stress GO:0006979 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP27904
No repeats found
|