<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27896
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MAEEQDSRRASLFPAPPTFYTHFTPANQEKLKEFQAAAKNDEDENASKELPAELVCLIPPKPPTEKYQSFGQIWTLPERHPTLKELNIPQLFPEPNNESYNVDRAQELRRLSKSLLLNYLELVGIMGMSPEEYAEKVYHLRIHLINIHELINNYRPHQARETLISMMEEQLEKSRQETEDNRKACAKLKELLGSLSTFDAGGLLTSDTATSADTVTSATSATATVTTATTIPSGNWEEKDSSSWEALQQAGL |
| Length | 252 |
| Position | Middle |
| Organism | Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491) (Nematode-trapping fungus) (Didymozoophaga oligospora) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Orbiliomycetes>
Orbiliales> Orbiliaceae> Orbilia> Arthrobotrys oligospora.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.638 |
| Instability index | 58.67 |
| Isoelectric point | 4.98 |
| Molecular weight | 28362.43 |
| Publications | PubMed=21909256
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27896
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.69| 10| 44| 14| 23| 1
---------------------------------------------------------------------------
14- 23 (23.05/13.79) PAPPTF.YTHF
60- 70 (17.64/ 9.02) PKPPTEkYQSF
---------------------------------------------------------------------------
|