Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MAEEQDSRRASLFPAPPTFYTHFTPANQEKLKEFQAAAKNDEDENASKELPAELVCLIPPKPPTEKYQSFGQIWTLPERHPTLKELNIPQLFPEPNNESYNVDRAQELRRLSKSLLLNYLELVGIMGMSPEEYAEKVYHLRIHLINIHELINNYRPHQARETLISMMEEQLEKSRQETEDNRKACAKLKELLGSLSTFDAGGLLTSDTATSADTVTSATSATATVTTATTIPSGNWEEKDSSSWEALQQAGL |
Length | 252 |
Position | Middle |
Organism | Arthrobotrys oligospora (strain ATCC 24927 / CBS 115.81 / DSM 1491) (Nematode-trapping fungus) (Didymozoophaga oligospora) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Orbiliomycetes> Orbiliales> Orbiliaceae> Orbilia> Arthrobotrys oligospora. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.638 |
Instability index | 58.67 |
Isoelectric point | 4.98 |
Molecular weight | 28362.43 |
Publications | PubMed=21909256 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364060 ECO:0000256 ARBA:ARBA00003669 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP27896 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 40.69| 10| 44| 14| 23| 1 --------------------------------------------------------------------------- 14- 23 (23.05/13.79) PAPPTF.YTHF 60- 70 (17.64/ 9.02) PKPPTEkYQSF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EKLKEFQ 2) RRASLF 3) THFTPAN | 29 8 21 | 35 13 27 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab