<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27895

Description Mediator complex subunit 14
SequenceMAPVQLENHQLVPPAASAPAPPPPGAAVAAAAAAAASPGYRLSTLIEFLLHRAYSELMVLTDLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWADNAGKVEKCAMISSFLDQQAILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRFTSFSTTKIVVFFEIHGSQNVSRYENGSGHLKKLKLSNTYATYGNFEYMLGRIENLVLNRLTSISDVKILHASCFSENSDTSITSQVQSFNVDLTSQLFGNTAFINEVCLYLMGCWNSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYHAGKCLSLSVWNQQVLGRKTGIASVHKVTIKIDENDVSKPLQIFHDPPLPGSDSKLAERAMKIDHLSIEKLLIDSVHARAHQKLQELKAILRGFNANENSSIESALPALVVPILEPCGNSECLHIFVDLHSGMFQLMLYGLDQATLDDMEKSVNDDMKRIIPWIQQLKFWLGQQRCKQSIKHLPTISSETLQLSNYSTHPIGNLSKNKLFIKLTRLPQYYIVVEMLEVPNKPTQLLYKYYFMSVNAADREDSPVMALLLQQFKENVQDFVFHTKTGKQTRTGTKRKLSDDPCPVESKKTKRSGEMCAFNKVLAHFVAMCDTNMPFVGLRLELSNLEIPHQGVQVEGDGFSHAIRLLKIPPCKGVNEETQKALDRSLLDCTFRLQGRNNRTWVAELVFANCPLNGTSTREQGPSRHVYLTYENLLSEPVGGRKVVEMFLNDWNSIARLYECVLEFARSLPDIPAHLNIFSEVRVYNYRKLILCYGTTKGSSISIQWNSIHQKFHISLGTVGPNSGCSNCHNTILHQLQEMFNKTPNVVQLLQVLFDTQAPLNAINKLPTVPMLGLTQRTNTAYQCFSILPQSSTHIRLAFRNMYCIDIYCRSRGVVAIRDGAYSLFDNSKLVEGFYPAPGLKTFLNMFVDSNQDARRRSVNEDDNPPSPIGGDMMDSLISQLQPPPQQQPFPKQPGTSGAYPLTSPPTSYHSTVNQSPSMMHTQSPGNLHAASSPSGALRAPSPASFVATPPPSSHGISIGPGASFASPHGTLDPSSPYTMVSPSGRAGNWPGSPQVSGPSPATRMPGMSPANPSLHSPVPDASHSPRAGTSSQTMPTNMPPPRKLPQRSWAASIPTILTHSALNILLLPSPTPGLVPGLAGSYLCSPLERFLGSVIMRRHLQRIIQQETLQLINSNEPGVIMFKTDALKCRVALSPKTNQTLQLKVTPENAGQWKPDELQVLEKFFETRVAGPPFKANTLIAFTKLLGAPTHILRDCVHIMKLELFPDQATQLKWNVQFCLTIPPSAPPIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNPPRQGECTIFAAVRDLMANLTLPPGGRP
Length1439
PositionTail
OrganismOryctolagus cuniculus (Rabbit)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Lagomorpha> Leporidae> Oryctolagus.
Aromaticity0.07
Grand average of hydropathy-0.154
Instability index50.87
Isoelectric point8.97
Molecular weight159136.72
Publications
PubMed=21993624

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coactivator activity	GO:0003713	IEA:Ensembl
GO - Biological Process
positive regulation of transcription initiation from RNA polymerase II promoter	GO:0060261	IEA:Ensembl
stem cell population maintenance	GO:0019827	IEA:Ensembl

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP27895
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     255.01|      54|      56|    1012|    1067|       1
---------------------------------------------------------------------------
  971- 1036 (75.40/36.25)	SPIGGDMMDS.LIS.QLQP..PPqqqpfP.....KQPGTS...GAypltspptSY...HSTVNqsPSMMH..TQSPGNLHAAS
 1037- 1085 (81.85/35.31)	SPSGALRAPS.PAS.FVAT..PP.....P.....SSHGISIGPGA........SFaspHGTLD..PSSPY..T........MV
 1086- 1130 (64.67/26.31)	SPSG..RAGNwPGSpQVSG..PS.....P.....ATRM....PG..............MSPAN..PS.LH..SPVPDASHSP.
 1131- 1173 (33.10/ 9.79)	......RAGT.SSQ.TMPTnmPP.....PrklpqRSWAASIPT...........................ilTHSALNILLLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      82.37|      21|      55|     102|     122|       4
---------------------------------------------------------------------------
   70-   89 (25.05/14.83)	.VERKIEIVQFASRTRQLFVR
  102-  122 (34.17/23.16)	KVEKCAMISSFLDQQAILFVD
  129-  147 (23.14/13.08)	SLARDALVHARLPSFAIPY..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.06|      24|      24|    1348|    1371|       5
---------------------------------------------------------------------------
 1347- 1370 (39.65/19.17)	KMLFFL..QLTQKTSVPPQEPVSIIV
 1371- 1396 (34.41/15.63)	PIIYDMasGTTQQADIPRQQNSSVAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      65.90|      15|      15|    1264|    1278|      10
---------------------------------------------------------------------------
 1244- 1260 (18.74/ 8.36)	QTLQLKVTPENAGqwKP
 1264- 1278 (27.08/15.35)	QVLEKFFETRVAG..PP
 1282- 1294 (20.08/ 9.48)	NTLIAF..TKLLG..AP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27895 with Med14 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) NQDARRRSVNEDDNPPSPIGGDMMDSLISQLQPPPQQQPFPKQPGTSGAYPLTSPPTSYHSTVNQSPSMMHTQSPGNLHAASSPSGALRAPSPASFVATPPPSSHGISIGPGASFASPHGTLDPSSPYTMVSPSGRAGNWPGSPQVSGPSPATRMPGMSPANPSLHSPVPDASHSPRAGTSSQTMPTNMPPPRKLPQRSWA
955
1155










Molecular Recognition Features






MoRF SequenceStartStop




NANANA