<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27873
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MENFTALFGAQADPPPPPAALGFGPGKPPPPPPPPPGGGPGTAPPPTAATAPPGTDKSVAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKNKKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPDRKRKKKEKKKKKSRHSPDHPGMGSSQASSSSSLR |
| Length | 244 |
| Position | Head |
| Organism | Oryctolagus cuniculus (Rabbit) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Lagomorpha> Leporidae> Oryctolagus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.996 |
| Instability index | 65.53 |
| Isoelectric point | 9.83 |
| Molecular weight | 26253.78 |
| Publications | PubMed=21993624
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27873
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 60.22| 12| 16| 199| 210| 2
---------------------------------------------------------------------------
172- 188 (17.27/ 6.18) KKNKKHKHkqsrtQDPV
199- 210 (22.04/ 9.65) KKKKKKKE.....EDPD
218- 228 (20.91/ 8.83) KKKKKSRH......SPD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.78| 13| 115| 113| 130| 4
---------------------------------------------------------------------------
113- 129 (20.85/16.35) PGMidlpGSHDNSSLRS
230- 242 (24.93/ 9.36) PGM....GSSQASSSSS
---------------------------------------------------------------------------
|