Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MAAVDIRDNLLGISWVDSSWIPILNSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGVEYILLHAQEPILFIIRKQQRQSPTQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDHEEQDKVKPKAKRKEEPSSIFQRQRVDALLVDLRQKFPPKFVQQKSGEKPVPVDQSKKEAEPVPETVKSEEKETTKNVQQTVSTKGPPEKRMRLQF |
Length | 247 |
Position | Head |
Organism | Oryctolagus cuniculus (Rabbit) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Lagomorpha> Leporidae> Oryctolagus. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.587 |
Instability index | 50.85 |
Isoelectric point | 8.69 |
Molecular weight | 28542.27 |
Publications | PubMed=21993624 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 PIRNR:PIRNR023869 href='https://www.uniprot.org/unirule/RU364151' style='color:#FF0000;'>RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP27869 No repeats found No repeats found |
IDR Sequence | Start | Stop |
1) FVQQKSGEKPVPVDQSKKEAEPVPETVKSEEKETTKNVQQTVSTKGPPEKRMRLQF | 192 | 247 |
MoRF Sequence | Start | Stop |
1) ALLVDLRQKFPPKFVQ 2) PPEKRMRLQF | 179 238 | 194 247 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab