<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27868
Description |
Uncharacterized protein |
Sequence | MAAPQQQAPGASSAAGVSGPGSAGGPGPQQQPPPPAQLVGSSQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGTSCRKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQIACAKDIHTALLDCANKVTGKTPAPPTGPGGTL |
Length | 203 |
Position | Tail |
Organism | Oryctolagus cuniculus (Rabbit) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Lagomorpha> Leporidae> Oryctolagus.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.376 |
Instability index | 69.17 |
Isoelectric point | 6.26 |
Molecular weight | 21357.02 |
Publications | PubMed=21993624
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP27868
No repeats found
|