<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27866
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGIKVKTEPMDADDSNNCTGQSEQQRENSGHRRDQIIEKDAALCVLIDEMNERP |
Length | 233 |
Position | Middle |
Organism | Oryctolagus cuniculus (Rabbit) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Lagomorpha> Leporidae> Oryctolagus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.712 |
Instability index | 53.03 |
Isoelectric point | 5.42 |
Molecular weight | 27162.85 |
Publications | PubMed=21993624
|
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP27866
No repeats found
|