<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27862
Description |
Uncharacterized protein |
Sequence | MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPTWAKGRGSWPISGLVRGVGHTSLPVDLTFWKNSLPDNEFILVLCFH |
Length | 223 |
Position | Head |
Organism | Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hylobatidae>
Nomascus.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.332 |
Instability index | 50.71 |
Isoelectric point | 5.96 |
Molecular weight | 24553.70 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | cortical actin cytoskeleton GO:0030864 IEA:Ensembl
nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | negative regulation of smooth muscle cell differentiation GO:0051151 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
Repeats |
>MDP27862
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.84| 15| 16| 117| 132| 2
---------------------------------------------------------------------------
117- 132 (21.37/20.60) ELRNELQ.RKDALVQkH
135- 150 (24.48/17.76) KLRHWQQvLEDINVQ.H
---------------------------------------------------------------------------
|