<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27831

Description Mediator of RNA polymerase II transcription subunit 1
SequenceXXXXXXNVVEFTIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAIMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNLKYYVSPSDLLDDKTASPIILHENNVSRSLGMNASVTIEGTSAMYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLPACFFLKFPQPIPVSRAFVQKLQNCTGIPLFETQPTYAPLYELITQFELSKDPDPIPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHPGRIPLILNLIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFSISFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGYGMTTGNNPMSGTTTPTNTFPGGPITTLFNMSMSIKDRHESVGHGEDFSKVSQNPILTSLLQITGNGGSTIGSSPTPPHHTPPPVSSMAGNTKNHPMLMNLLKDNPAQDFSTLYGSSPLERQNSSSGSPRMEICSGSNKTKKKKSSRLPPEKPKHQTEDDFQRELFSMDVDSQNPIFDVNMTADTLDTPHITPAPSQCSTPPTTYPQPVPHPQPSIQRMVRLSSSDSIGPDVTDILSDIAEEASKLPSTSDDCPAIGTPLRDSSSSGHSQSTLFDSDVFQTNNNENPYTDPADLIADAAGSPSSDSPTNHFFHDGVDFNPDLLNSQSQSGFGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPFTPPTSTGGSKSPGSSGRSQTPPGVATPPIPKITIQIPKGTVMVGKPSSHSQYTSSGSVSSSGSKSHHSHSSSSSSSSASTSGKMKSSKSEGSSSSKLSSSMYSSQGSSGSSQSKNSSQSGGKPGSSPITKHGLSGGSSSTKMKPQGKPSSLMNPSLSKPNISPSHSRPPGGSDKLASPMKPVPGTPPSSKAKSPISSGSGGSHMSGTSSSSGMKSSSGLGSSGSLSQKTPPSSNSCTASSSSFSSSGSSMSSSQNQHGSSKGKSPSRNKKPSLTAVIDKLKHGVVTSGPGGEDPLDGQMGVSTNSSSHPMSSKHNMSGGEFQGKREKSDKDKSKVSTSGSSVDSSKKTSESKNVGSTGVAKIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLPEYSTEKHKKHKKEKKKVKDKDRDRDRDKDRDKKKSHSIKPESWSKSPISSDQSLSMTSNTILSADRPSRLSPDFMIGEEDDDLMDVALIGN
Length1558
PositionMiddle
OrganismNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hylobatidae> Nomascus.
Aromaticity0.04
Grand average of hydropathy-0.661
Instability index53.35
Isoelectric point8.86
Molecular weight165095.40
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364059

GO - Cellular Component
mediator complex	GO:0016592	ISS:UniProtKB
nucleolus	GO:0005730	ISS:UniProtKB
nucleoplasm	GO:0005654	IEA:Ensembl
nucleus	GO:0005634	ISS:UniProtKB

GO - Biological Function
chromatin binding	GO:0003682	ISS:UniProtKB
DNA binding	GO:0003677	IEA:Ensembl
estrogen receptor binding	GO:0030331	IEA:Ensembl
LBD domain binding	GO:0050693	IEA:Ensembl
nuclear receptor coactivator activity	GO:0030374	ISS:UniProtKB
peroxisome proliferator activated receptor binding	GO:0042975	IEA:Ensembl
promoter-specific chromatin binding	GO:1990841	IEA:Ensembl
protein-containing complex binding	GO:0044877	IEA:Ensembl
retinoic acid receptor binding	GO:0042974	IEA:Ensembl
thyroid hormone receptor binding	GO:0046966	ISS:UniProtKB
transcription coactivator activity	GO:0003713	ISS:UniProtKB
transcription coregulator activity	GO:0003712	ISS:UniProtKB
transcription corepressor activity	GO:0003714	ISS:UniProtKB
vitamin D receptor binding	GO:0042809	IEA:Ensembl

GO - Biological Process
androgen biosynthetic process	GO:0006702	ISS:UniProtKB
angiogenesis	GO:0001525	ISS:UniProtKB
animal organ regeneration	GO:0031100	IEA:Ensembl
brain development	GO:0007420	IEA:Ensembl
cell morphogenesis	GO:0000902	ISS:UniProtKB
cellular response to epidermal growth factor stimulus	GO:0071364	ISS:UniProtKB
cellular response to hepatocyte growth factor stimulus	GO:0035729	IEA:Ensembl
cellular response to thyroid hormone stimulus	GO:0097067	IEA:Ensembl
embryonic heart tube development	GO:0035050	IEA:Ensembl
embryonic hemopoiesis	GO:0035162	IEA:Ensembl
embryonic hindlimb morphogenesis	GO:0035116	IEA:Ensembl
embryonic placenta development	GO:0001892	IEA:Ensembl
enucleate erythrocyte development	GO:0048822	IEA:Ensembl
epithelial cell proliferation involved in mammary gland duct elongation	GO:0060750	IEA:Ensembl
erythrocyte development	GO:0048821	ISS:UniProtKB
fat cell differentiation	GO:0045444	IEA:Ensembl
intracellular steroid hormone receptor signaling pathway	GO:0030518	ISS:UniProtKB
keratinocyte differentiation	GO:0030216	ISS:UniProtKB
lactation	GO:0007595	IEA:Ensembl
lens development in camera-type eye	GO:0002088	ISS:UniProtKB
liver development	GO:0001889	IEA:Ensembl
mammary gland branching involved in pregnancy	GO:0060745	IEA:Ensembl
mammary gland branching involved in thelarche	GO:0060744	IEA:Ensembl
megakaryocyte development	GO:0035855	ISS:UniProtKB
monocyte differentiation	GO:0030224	IEA:Ensembl
mRNA transcription by RNA polymerase II	GO:0042789	ISS:UniProtKB
negative regulation of apoptotic process	GO:0043066	ISS:UniProtKB
negative regulation of keratinocyte proliferation	GO:0010839	ISS:UniProtKB
negative regulation of neuron differentiation	GO:0045665	ISS:UniProtKB
negative regulation of transcription by RNA polymerase II	GO:0000122	ISS:UniProtKB
peroxisome proliferator activated receptor signaling pathway	GO:0035357	IEA:Ensembl
positive regulation of erythrocyte differentiation	GO:0045648	IEA:Ensembl
positive regulation of G0 to G1 transition	GO:0070318	IEA:Ensembl
positive regulation of gene expression	GO:0010628	ISS:UniProtKB
positive regulation of hepatocyte proliferation	GO:2000347	IEA:Ensembl
positive regulation of interferon-gamma-mediated signaling pathway	GO:0060335	IEA:Ensembl
positive regulation of intracellular estrogen receptor signaling pathway	GO:0033148	IEA:Ensembl
positive regulation of keratinocyte differentiation	GO:0045618	ISS:UniProtKB
positive regulation of transcription by RNA polymerase II	GO:0045944	ISS:UniProtKB
positive regulation of transcription initiation from RNA polymerase II promoter	GO:0060261	ISS:UniProtKB
protein import into nucleus	GO:0006606	IEA:Ensembl
regulation of RNA biosynthetic process	GO:2001141	ISS:UniProtKB
regulation of vitamin D receptor signaling pathway	GO:0070562	IEA:Ensembl
retinal pigment epithelium development	GO:0003406	IEA:Ensembl
thyroid hormone generation	GO:0006590	IEA:Ensembl
thyroid hormone mediated signaling pathway	GO:0002154	ISS:UniProtKB
ventricular trabecula myocardium morphogenesis	GO:0003222	IEA:Ensembl









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP27831
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             7|     325.85|      40|      41|    1051|    1090|       1
---------------------------------------------------------------------------
 1051- 1090 (71.77/25.68)	GK..PSS.HSQYTS..SGSVSSSGSKSHHSHSSSS....S.SSSAST....S.GK
 1102- 1143 (44.50/12.19)	SK..LSS..SMYSS..QGSSGSSQSK.NSSQSGGK....P.GSSPITkhglS.GG
 1153- 1188 (41.36/10.64)	GK..PSSlMNPSLS..KPNISPS.....HSRPPGG....S.DKLASP....M.KP
 1192- 1231 (44.96/12.42)	TP..PSS.KAK......SPISSGSGGSHMSGTSSSsgmkS.SSGLGS....S.GS
 1234- 1270 (49.82/14.82)	QKtpPSS.NSCTAS..SSSFSSSGS.SM....SSS....Q.NQHGSS....K.GK
 1285- 1326 (37.03/ 8.49)	DK...LK.HGVVTSgpGGEDPLDGQMGVSTNSSSH....PmSSKHNM....S.GG
 1330- 1368 (36.40/ 8.18)	GK..REK.SDKDKS....KVSTSGSSVDSSKKTSE....S.KNVGST....GvAK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     200.14|      50|      50|     300|     349|       2
---------------------------------------------------------------------------
  262-  303 (67.13/37.70)	PSF.SSITSANSVDLPACFFL.KFPQPIPVSRA.................FVQKL...Q............nCTGI
  304-  349 (83.73/49.02)	PLFETQPTYAPLYELITQFELSKDPDPIPLNHNM...............RFYAALPGQQHC...............
  414-  480 (49.27/25.53)	LQFEV....CPLSE..SRFSISFQH...PVNDSLvcvvmdvqdsthvscKLYKGLSDALICtddfiakvvqrCMSI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.25|      20|      20|    1418|    1437|       4
---------------------------------------------------------------------------
 1404- 1423 (29.78/10.78)	SSKNYGSPLISGSTPKHERG
 1424- 1443 (33.47/13.17)	SPSHSKSPAYTPQNLDSESE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.38|      16|      20|     517|     534|       5
---------------------------------------------------------------------------
  517-  533 (30.26/11.15)	PPASSPGYGmTTGNNPM
  605-  620 (28.12/ 6.38)	PPPVSSMAG.NTKNHPM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      86.86|      20|      64|    1380|    1400|       6
---------------------------------------------------------------------------
 1380- 1400 (27.04/14.69)	SIKAKVTLQKPgESSGEGLRP
 1447- 1465 (33.06/13.95)	SIAEKSYQNSP..SSDDGIRP
 1504- 1522 (26.75/ 9.48)	SIKPESWSKSP.ISSDQSLS.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     118.63|      37|      52|     122|     159|       7
---------------------------------------------------------------------------
  122-  159 (59.67/41.21)	NFDEFSKHLKGLVNlYNLP..GDNKLKTKMYLALQSLEQD
  172-  210 (58.97/36.44)	NAGPLDKILHGSVG.YLTPrsGGHLMNLKYYVSPSDLLDD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.93|      31|      52|     957|     987|       8
---------------------------------------------------------------------------
  654-  685 (28.50/ 6.50)	MEICSGSNKTKKKKSSRLPPEKPKHQTEDDfQ
  957-  987 (51.43/17.99)	STLSGPGLDSKPGKRSRTPSNDGKSKDKPP.K
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     200.07|      54|      59|     753|     811|       9
---------------------------------------------------------------------------
  754-  802 (70.87/39.04)	..........DVTDILSDIAEEASKLPSTSdDCPA.........IGTPLRDSSSSGHSQSTLFDSDVF
  803-  859 (63.88/35.15)	QTNNNEnpytDPADLIADAAGS....PSS..DSPTnhffhdgvdFNPDLLNS....QSQSG.FGEEYF
  864-  906 (65.32/31.00)	QSGDND...........DFKGFASQALNTL.GVPM.........LGGDNGETKFKGNNQADTVD....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.83|      21|     498|      47|      71|      11
---------------------------------------------------------------------------
   47-   71 (32.17/31.53)	VTSLPAMT....DRLESIarqnGLGSHLS
  548-  572 (34.65/22.36)	ITTLFNMSmsikDRHESV....GHGEDFS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.52|      12|      15|    1472|    1483|      13
---------------------------------------------------------------------------
 1472- 1483 (19.60/10.38)	EKHKKHKKEKKK
 1490- 1501 (19.91/10.65)	DRDRDKDRDKKK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27831 with Med1 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) AGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPFTPPTSTGGSKSPGSSGRSQTPPGVATPPIPKITIQIPKGTVMVGKPSSHSQYTSSGSVSSSGSKSHHSHSSSSSSSSASTSGKMKSSKSEGSSSSKLSSSMYSSQGSSGSSQSKNSSQSGGKPGSSPITKHGLSGGSSSTKMKPQGKPSSLMNPSLSKPNISPSHSRPPGGSDKLASPMKPVPGTPPSSKAKSPISSGSGGSHMSGTSSSSGMKSSSGLGSSGSLSQKTPPSSNSCTASSSSFSSSGSSMSSSQNQHGSSKGKSPSRNKKPSLTAVIDKLKHGVVTSGPGGEDPLDGQMGVSTNSSSHPMSSKHNMSGGEFQGKREKSDKDKSKVSTSGSSVDSSKKTSESKNVGSTGVAKIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLPEYSTEKHKKHKKEKKKVKDKDRDRDRDKDRDKKKSHSIKPESWSKSPISSDQSLSMTSNTILSADRPSRLSPDFMIGEEDDDLMDVALIGN
2) FNMSMSIKDRHESVGHGEDFSKVSQNPILTSLLQITGNGGSTIGSSPTPPHHTPPPVSSMAGNTKNHPMLMNLLKDNPAQDFSTLYGSSPLERQNSSSGSPRMEICSGSNKTKKKKSSRLPPEKPKHQTEDDFQRELFSMDVDSQNPIFDVNMTADTLDTPHITPAPSQCSTPPTTYPQPVPHPQPSIQRMVRLSSSDSIGPDVTDILSDIAEEASKLPSTSDDCPAIGTPLRDSSSSGHSQSTLFDSDVFQTNNNENPYTDPADLIADAAGSPSSDSPTNHFFHDGVDFN
3) KNLPPASSPGYGMTTGNNPMSGTTTPTNTFPGGP
4) QSQSGFGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADT
913
552
514
849
1558
842
547
904










Molecular Recognition Features






MoRF SequenceStartStop




NANANA