<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27827
Description |
Mediator of RNA polymerase II transcription subunit 15 |
Sequence | GHQRKTRVSQNSLTMQGQQVQTPQSMPPPPRPSPQPGQPSSQPNSNVSPGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPVHTPVDSSSVPSPAGSSQAEEQQYLDKLKQLSKYIEPLRCMINKIDENEDRKEDLSMMKSLLETLTDLSKRCPLETLQKCEIALEKLENDMAVPMPPPPPGPPTKQQSLCQPLLDAVLANICSPVFNHSLYRTFVPAMTAIHGPPITAPVVCAQKRKLEEDERQSIPNVLQREVAGLDPKFLVNLDPSHSNDNGTVHLICKLDDKDLPSVPHLELSVPADYPAQSPLWIDRQWQYDASPFLQSVYRCMTSRLLKLPDKHSVTALLNTWAESIHQACLSAA |
Length | 366 |
Position | Tail |
Organism | Myotis lucifugus (Little brown bat) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Chiroptera> Microchiroptera> Vespertilionidae>
Myotis.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.550 |
Instability index | 80.61 |
Isoelectric point | 6.16 |
Molecular weight | 40185.27 |
Publications | PubMed=21993624
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364148
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP27827
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 118.85| 21| 153| 23| 43| 1
---------------------------------------------------------------------------
23- 43 (48.84/17.09) PQSMP.PPPRPSPQPGQPS.SQP
76- 97 (33.17/ 9.28) PQNFSvPSPGPVHTPVDSS.SVP
180- 198 (36.84/11.11) P..MP.PPP.PGPPTKQQSlCQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.42| 26| 34| 111| 141| 2
---------------------------------------------------------------------------
111- 141 (38.45/33.34) LDKLKQLSKyieplRCMINKIDENEDRKEDL
148- 173 (43.97/25.72) LETLTDLSK.....RCPLETLQKCEIALEKL
---------------------------------------------------------------------------
|