<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27822

Description Uncharacterized protein
SequenceMAAAPSSLQQIRDRLLQAIDSQSNNQNIVVVLEIISSLEKYPITKEALEETRLGKLINDLRKKTKNEGLAKRKKLLRNWQKLIEPXMAPLVSNSSLSPSIEIGGSPESFPGPLGAGLLGPESSCSKQVRNDKQGIMIPINSVRSHTSSPGLGKPSRPCVQSKAAVQQQLERADQTSGPPHPKGPPRSSFSPRNSRHKGSFARQRSPYSPKGSVPSPLPRPQSLDVTQVPSPLPLAQPCTHPVRRPELLPSAESPVHWLEQPEGHQRLAGPVCKAGLSPAESILPRAGFSPDSSRADSDAASSGGSGRKRKRSQPRDYTVNLGGQVAEAGVKPVRLKERKLTLDPMTRQIKPLTQKEPVRADSPVHTEQPRTGLDKPEAKTSLQSPFEQMNRMELSRNEIIQSHLSPQSSLLSSSSAQTPGAHHFMSEFLKQKESTQRGARTPQVLLPPGPSTDLPELSRQVTQNDLDRIHAHRWPGVNECLDTLGNWYDWTQCISLDPHGDGGRLNILPYVCLD
Length514
PositionUnknown
OrganismMyotis lucifugus (Little brown bat)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Chiroptera> Microchiroptera> Vespertilionidae> Myotis.
Aromaticity0.03
Grand average of hydropathy-0.712
Instability index73.86
Isoelectric point9.68
Molecular weight56111.95
Publications
PubMed=21993624

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP27822
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     117.09|      26|      27|     229|     254|       1
---------------------------------------------------------------------------
  205-  227 (23.99/ 7.42)	.SPYSPKGSVPSPLPRPQSLDVTQ..
  229-  254 (51.83/24.33)	PSPLPLAQPCTHPVRRPELLPSAESP
  361-  385 (41.27/17.91)	DSPVHTEQPRT.GLDKPEAKTSLQSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.94|      12|      27|     145|     156|       2
---------------------------------------------------------------------------
  145-  156 (23.75/11.00)	HTSSPGLGK.PSR
  174-  186 (22.19/ 9.72)	QTSGPPHPKgPPR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.05|      13|      16|     277|     289|       3
---------------------------------------------------------------------------
  277-  289 (23.21/13.22)	SPAESILPRAGFS
  293-  305 (21.84/12.00)	SRADSDAASSGGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.17|      17|     332|     110|     131|       4
---------------------------------------------------------------------------
  110-  131 (22.07/24.45)	PGPlGAGLlgPEssCSKQV.RND
  448-  465 (30.10/14.16)	PGP.STDL..PE..LSRQVtQND
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.17|      18|      22|     311|     332|       6
---------------------------------------------------------------------------
  306-  324 (27.84/20.13)	GRKRkRSQPRDYTVN.LGGQ
  329-  348 (22.33/ 6.34)	GVKPvRLKERKLTLDpMTRQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.94|      14|      17|     408|     421|       7
---------------------------------------------------------------------------
  408-  421 (22.09/12.47)	SSLLSSSSAQTPGA
  426-  439 (22.85/13.15)	SEFLKQKESTQRGA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27822 with Med26 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) GAHHFMSEFLKQKESTQRGARTPQVLLPPGPSTDLPELSRQVTQNDLDR
2) SSLSPSIEIGGSPESFPGPLGAGLLGPESSCSKQVRNDKQGIMIPINSVRSHTSSPGLGKPSRPCVQSKAAVQQQLERADQTSGPPHPKGPPRSSFSPRNSRHKGSFARQRSPYSPKGSVPSPLPRPQSLDVTQVPSPLPLAQPCTHPVRRPELLPSAESPVHWLEQPEGHQRLAGPVCKAGLSPAESILPRAGFSPDSSRADSDAASSGGSGRKRKRSQPRDYTVNLGGQVAEAGVKPVRLKERKLTLDPMTRQIKPLTQKEPVRADSPVHTEQPRTGLDKPEAKTSLQSPFEQMNRMELSRNEIIQSHLSPQSSLLSSSSAQT
420
94
468
418










Molecular Recognition Features






MoRF SequenceStartStop




NANANA