<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27816
| Description |
Uncharacterized protein |
| Sequence | SVTPGQGLPPIAQPGPPSMVGTVSQGEESGPSPAPLGVLVLSEQQPISKKSLAWSGVLEWKEKFKPGTNIPLMRSLPCQVYVDHGENLKTDLWPQKLIMNLFPSQLLIPLGHYIRNSRRVQFSFTNLDLESHKSLYRMIGNGCGGFVHFLFMDHSKLRIYMLLLSRKKKTFMGLIPYDQKGFLNRMGQIVRRELKKGEQALPGLSPLLEDQASSSQNLLLLRQPQSEPQGTVEAAAASGQPQPSVLPRFPPGTAQGPPRTAPSLPLLHLSFGPRTLGPTVASPPQPTPDPVRPPFVRVQPPPPPPXSRLPHCSHRGPCIVDTTHRAWGCPLGPPLLQLPLTQPRPAQLPPGAPLPGHMLLSFG |
| Length | 363 |
| Position | Unknown |
| Organism | Myotis lucifugus (Little brown bat) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Chiroptera> Microchiroptera> Vespertilionidae>
Myotis.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.294 |
| Instability index | 54.06 |
| Isoelectric point | 9.94 |
| Molecular weight | 39435.49 |
| Publications | PubMed=21993624
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP27816
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.42| 19| 23| 249| 271| 3
---------------------------------------------------------------------------
250- 271 (27.69/14.46) PPGTAQGPPrTAPsLP..LLhLSF
342- 362 (33.74/ 6.29) QPRPAQLPP.GAP.LPghML.LSF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.50| 20| 24| 62| 85| 4
---------------------------------------------------------------------------
50- 71 (28.88/17.57) KSLAWSGVLEWKEKFKpgTNI.P
74- 94 (31.62/18.81) RSLPCQVYVDHGENLK..TDLwP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 32.55| 11| 24| 120| 135| 5
---------------------------------------------------------------------------
120- 135 (10.65/26.25) VQFSFtnLDlesHKSL
147- 157 (21.90/17.95) VHFLF..MD...HSKL
---------------------------------------------------------------------------
|