<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27787

Description Mediator of RNA polymerase II transcription subunit 15
SequenceEDAMRKAGVAHSKSSKDMESHVFLKAKTREEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPSRGPGQSLGGMGGLGAMGQPMPLSGQPPPGTSGMAPHGMAVVSTATPQTQLQLQQVALQQQQQQQQQFQQQQAALQQQQQQQFQAQQNAMQQQFQAVVQQQQQQLQQQQQQQQHLLKLHHQNQQQIQQQQQLQRMAQLQLQQQQQQQALQAQPPMQQPPMQQPQPPPSQALPQQLQQMHHPQHHQPQPQPQQPPVAQNQPSQLPPQSQTQPLVSQAPALPGQMLYPQPPLKLVRAPMVVQQPQVQPPVQQQTAPTAQAPQIVGSGVQMIAEALAQGGMQVRARFPPTTAVSAVQSSSIPLGREPSAQEIWNSSMVNWCISNPVPSKKKGTAQVGTPPPPPECTNFCAPNTGQSKXPCPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRKLEEDERQSIPNVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAESIHQACLSAA
Length750
PositionTail
OrganismMyotis lucifugus (Little brown bat)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Chiroptera> Microchiroptera> Vespertilionidae> Myotis.
Aromaticity0.03
Grand average of hydropathy-0.647
Instability index81.36
Isoelectric point9.30
Molecular weight82280.95
Publications
PubMed=21993624

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
nucleoplasm	GO:0005654	IEA:Ensembl

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP27787
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     135.92|      18|      19|     133|     150|       1
---------------------------------------------------------------------------
  133-  150 (37.76/ 9.95)	QQVALQQQQQQQQQFQQQ
  174-  191 (34.02/ 8.07)	QAVVQQQQQQLQQQQQQQ
  235-  252 (32.39/ 7.25)	QQPPMQQPQPPPSQALPQ
  253-  270 (31.75/ 6.93)	QLQQMHHPQHHQPQPQPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.40|      19|      19|     305|     323|       2
---------------------------------------------------------------------------
  298-  322 (30.50/ 7.53)	LPQPPLKLVRAPMVVQQPQ
  443-  461 (28.90/ 6.72)	LPSPSPQPSQSPVTARTPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     110.67|      23|     150|     405|     431|       4
---------------------------------------------------------------------------
  354-  374 (33.46/ 6.17)	QGGMQVRARFPP..TTAVSAVQS
  375-  396 (30.36/ 6.67)	.SSIPLGREPSAQEIWNSSMVNW
  407-  429 (46.85/23.07)	KGTAQVGTPPPPPECTNFCAPNT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      85.87|      17|      19|      63|      79|       5
---------------------------------------------------------------------------
   63-   79 (32.91/16.84)	QSLTGGPAAGAAGI...GMP
   85-   99 (29.43/14.20)	QSLGGMGGLGA..M...GQP
  100-  118 (23.53/ 9.72)	MPLSGQPPPGTSGMaphGM.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      79.22|      15|      21|     195|     209|       6
---------------------------------------------------------------------------
  195-  209 (27.70/ 8.66)	LKLHHQNQQQIQQQQ
  217-  231 (26.23/ 7.74)	LQLQQQQQQQALQAQ
  280-  294 (25.29/ 7.15)	SQLPPQSQTQPLVSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.40|      23|      28|     525|     551|       7
---------------------------------------------------------------------------
  516-  543 (35.23/21.80)	DKNEdrkkdLSKMKSLLDILTDPSKRCP
  548-  572 (39.17/16.36)	QKCE...iaLEKLKNDMAVPTPPPPPVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      34.05|      11|     140|     462|     500|       8
---------------------------------------------------------------------------
  462-  476 (15.22/13.96)	NFsvpsPGPLNTPVN
  503-  513 (18.83/12.03)	KY....IEPLRRMIN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     143.41|      42|     128|     575|     618|      10
---------------------------------------------------------------------------
  577-  618 (74.87/59.97)	QYLCQPLLDAVLANIRSPVF....NHSLYRTFVPAMTAIHGPPITA
  704-  749 (68.54/47.20)	QYDANPFLQSVHRCMTSRLLqlpdKHSVTALLNTWAESIHQACLSA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27787 with Med15 domain of Kingdom Metazoa
Unable to open file!