Description | Mediator complex subunit 30 |
Sequence | MSTPPLAASGMAPGPFAGPQVPQATREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLAKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEASQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNK |
Length | 149 |
Position | Head |
Organism | Myotis lucifugus (Little brown bat) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Chiroptera> Microchiroptera> Vespertilionidae> Myotis. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.538 |
Instability index | 48.18 |
Isoelectric point | 5.71 |
Molecular weight | 16689.77 |
Publications | PubMed=21993624 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl |
GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl transcription coactivator activity GO:0003713 IEA:Ensembl |
GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl stem cell population maintenance GO:0019827 IEA:Ensembl |
Binary Interactions |
Repeats | >MDP27782 No repeats found |
MoRF Sequence | Start | Stop |
1) QLIPYVEE 2) RFASEERREIAEVNK | 115 135 | 122 149 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab