<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27780
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAAASLGEKEKERVGGGSGAACGKSTRERLLSVLDDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEQEVEKRDSDIRRLQKQLKEAEQILATAVYQAKEKLKSIDTARKGAISSEEIIKYAHRISASHAVCAPTTWVPGDPRRPYPRDLEMRSGLLGQMNNPSTNGVNGPLPGDALAAGRLPDVLAPQYPRQSNDMAMNMLPPNHSNDFLLKPPGHKKENEDDVEFMSTDSSSSSDSD |
| Length | 269 |
| Position | Middle |
| Organism | Myotis lucifugus (Little brown bat) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Chiroptera> Microchiroptera> Vespertilionidae>
Myotis.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.641 |
| Instability index | 43.70 |
| Isoelectric point | 5.50 |
| Molecular weight | 29729.26 |
| Publications | PubMed=21993624
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27780
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 101.41| 24| 24| 214| 237| 1
---------------------------------------------------------------------------
175- 194 (22.18/10.13) .....P.YPRDL.EMRSGLLGQmnNPS
214- 237 (45.05/27.18) D.VLAPQYPRQSNDMAMNMLPP..NHS
239- 263 (34.18/19.08) DfLLKPPGHKKENEDDVEFMST..DSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 101.50| 27| 28| 55| 81| 2
---------------------------------------------------------------------------
29- 49 (29.88/17.63) RLLSVLD...D...LEVL..SR..ELIEMLA
55- 81 (45.76/30.41) KLLQAGE...ENQVLELLI.HRDGEFQELMK
84- 112 (25.86/14.39) ..LNQGKihhEMQVLEQEVeKRDSDIRRLQK
---------------------------------------------------------------------------
|