<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27778

Description Mediator complex subunit 14
SequenceHLPWQLENHQLVPPGGGGGGSSGPASAPAPPPPGAAVAAAAAAAASPGYRLSTLIEFLLHRAYSELMVLTDLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISSFLDQQAILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKTEKQATLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDVPWRLLKLEILVEDKETGDGRALVHSMQINFIHQLVQSRLFADEKPLQDMYNCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYHPGKCLSLSVWNQQILGRKTGTASVHKVTIKIDENDGSKPLQIFHDPPLPASDSKLVEKAMKIDHLSIEKLLIDSVRARAHQKLQELKTILRGYNANENSSIETALPALVVPILEPCGNSECLHIFVDLHSGMFQLMLYGLDQATLDDMEKSVNDDMKRIVPWVQQLKFWLGQQRCKQSIKHLPTISTETLQLSNYSTHPIGKLSKNKLFIKLTRLPQYYIVVEMLEVPNKPTQLSYKYYFLSVSAAERDDGPVMALLLQQFKDNIQELILRTKTGKQPRAGTKRKLSDDTCPLEPKKTKRSGEMCAFNKILAHFVAVCDTNMPFVGLRLELSNLEIPHQGVQMEGDGFSHAIRLLKIPPCKGVSEETQKALDRSLLDCTFRLQGRNNRTWVAELVFANCPLNGTSTREQGPSRHVYLTYENLLSEPVGGRKVVEMFLNDWNSIARLYECVLEFARSLPALDIPAHLNIFSEVRVYNYRKLILCYGTTKGSSISIQWNSIHQKFHISLGTVGPNSGCSNCHNTILHQLQEMFNKIPNVVQLLQVLFDTQAPLNAINKLPTVPMLGLTQRTNTAYQCFSILPQSSTHIRLAFRNMYCIDIYCRSRGVVAIRDGAYSLFDNSKLVEGFYPAPGLKTFLNMFVDSNQDARRRSVNEDDNPPSPIGGDMMDSLISQLQPPPQQQPFPKQPGSSGAYPLTSPPTSYHNTVSPSPSMMHTQSPGNLHAASSPSGALRAPSPASFVPTPPPSSHGLSIGPGASFASPHGALDPSSPYTMVSPSGRAGNWPGSPQVSGPSPATRLPGMSPANPSLHSPVPDASHSPRAGTSSQTMPTNMPPPRKLPQRSWAASIPTILTHSALNNLLMPSPTPGFVPGLAGSYLCSPLERFLGSVIMRRHLQRIIQQETLQLINSNEPGVIMFKTDALKCRVALSPKTNQTLQLKVTPENTGQWKPDELQVLEKFFETRVAGPPFKANTLIAFTKLLGAPTHILRDCVHIMKLELFPDQATQLKWNVQFCLTIPPSAPPIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNPPRQGECTIFAAVRDLMANLTLPPGGRP
Length1456
PositionTail
OrganismMyotis lucifugus (Little brown bat)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Chiroptera> Microchiroptera> Vespertilionidae> Myotis.
Aromaticity0.07
Grand average of hydropathy-0.199
Instability index51.67
Isoelectric point9.03
Molecular weight160912.02
Publications
PubMed=21993624

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coactivator activity	GO:0003713	IEA:Ensembl

GO - Biological Process
positive regulation of transcription initiation from RNA polymerase II promoter	GO:0060261	IEA:Ensembl
stem cell population maintenance	GO:0019827	IEA:Ensembl









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP27778
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     240.36|      32|      32|    1036|    1067|       1
---------------------------------------------------------------------------
   13-   31 (24.38/ 6.21)	......PPGG.GGGGSSGP...A...SAPAPP..........
 1004- 1029 (42.93/17.51)	......PPPQ....QQPFPKQPG...SSGAYPLTSP...PTS
 1030- 1066 (53.90/24.19)	YhntvsPSPSMMHTQSPGNLHAA...SSPSGALRAP..SPAS
 1067- 1100 (49.52/21.52)	F..vptPPPS.SHGLSIGPGASF...ASPHGALDPS..SPYT
 1101- 1133 (33.59/11.82)	M...vsPSG......RAGNWPGSpqvSGPSPATRLPgmSPAN
 1135- 1163 (36.05/13.32)	S..lhsPVPDASHSPRAG....T...SSQTMPTNMP..PP..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      83.03|      24|      29|    1328|    1353|       2
---------------------------------------------------------------------------
 1328- 1353 (43.68/30.52)	PdqATQLKWNVQFC..LTIPPSAPPIAP
 1357- 1382 (39.36/21.04)	P..AVVLKSKMLFFlqLTQKTSVPPQEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.33|      10|      29|    1404|    1413|       3
---------------------------------------------------------------------------
 1404- 1413 (17.56/ 9.64)	PRQQNSSVAA
 1430- 1439 (19.77/11.85)	PRQGECTIFA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.49|      14|      29|     168|     181|       4
---------------------------------------------------------------------------
  168-  181 (26.30/17.07)	RLPTCIRDKII....PPD
  194-  211 (19.19/ 9.99)	QLNQILRHRLVttdlPPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.35|      21|      30|    1228|    1250|       5
---------------------------------------------------------------------------
 1228- 1250 (31.78/28.93)	QETLQL.INSNEPGviMFKTDALK
 1260- 1281 (34.57/24.05)	NQTLQLkVTPENTG..QWKPDELQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     118.38|      32|      32|     272|     303|       7
---------------------------------------------------------------------------
  246-  268 (21.53/11.82)	....RLLKLEILVEDKETGDGRAL..VH.S.....
  272-  303 (56.37/45.40)	NFIHQLVQSRLFADEKPLQDMYNC..LH.SFCLSL
  306-  337 (40.48/30.08)	EVLHS..QTLMLIRER.WGDLVQVerYHpGKCLSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      95.19|      29|      30|      69|      97|       8
---------------------------------------------------------------------------
   69-   97 (46.39/37.15)	LTDLLPRKSDVERKIEIVQFASRTRQLFV
  102-  130 (48.79/39.52)	LVKWANNAGKVEKCAMISSFLDQQAILFV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.25|      20|     157|     340|     359|      11
---------------------------------------------------------------------------
  340-  359 (36.78/21.38)	WNQQI...LGRKTGTASV.HKVTI
  492-  515 (29.47/15.77)	WVQQLkfwLGQQRCKQSIkHLPTI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     143.23|      33|     128|     661|     694|      12
---------------------------------------------------------------------------
  661-  693 (57.71/39.76)	LSNLEIP.HQGVQMEGDGFSHAIRLLKIPPCKGV
  787-  819 (43.52/26.09)	LPALDIPaHLNIFSEVRVYNYRKLILCYGTTKG.
  820-  846 (42.00/28.32)	.SSISIQ.WNSIHQK...F.H.ISLGTVGPNSGC
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27778 with Med14 domain of Kingdom Metazoa
Unable to open file!