<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27775
Description |
Uncharacterized protein |
Sequence | MAQKRALPQSKETLLQSYHKQLKDDIKSMMDNFTEIIKTAKIEDETQVSRATQGKQDNYEMHVRASNIVRAGESLMKLVSDLKQFLILNDFPSVNQAIDQRNQQFRALQEECDRKLTALRDEVSIDLYQLEEAYYSSSSSLREDNDLPLCEVYRRLDLDTDAADGLVAPLRASPEPSAGPLQPAARAHSHASGPGPTEHA |
Length | 200 |
Position | Head |
Organism | Myotis lucifugus (Little brown bat) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Chiroptera> Microchiroptera> Vespertilionidae>
Myotis.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.688 |
Instability index | 62.57 |
Isoelectric point | 5.16 |
Molecular weight | 22486.89 |
Publications | PubMed=21993624
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP27775
No repeats found
|