<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27771

Description Cyclin dependent kinase 8
SequenceHRKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIGKFAICCLFQSTLLVFKHSYHTGKSEFDLKRTFSHLSLHCLCSLFSLFPFSINKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKTIEKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSTTSQQPPQYSHQTHRY
Length430
PositionKinase
OrganismMeleagris gallopavo (Wild turkey)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda> Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Phasianidae> Meleagridinae> Meleagris.
Aromaticity0.09
Grand average of hydropathy-0.596
Instability index45.11
Isoelectric point9.23
Molecular weight49272.88
Publications
PubMed=20838655

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:Ensembl
nucleolus	GO:0005730	IEA:Ensembl
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:Ensembl
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP27771
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.35|      14|      16|     190|     203|       1
---------------------------------------------------------------------------
  190-  203 (27.55/16.21)	FKH.SYHTGKSEFDL
  207-  221 (23.80/13.14)	FSHlSLHCLCSLFSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.44|      15|      35|     110|     124|       2
---------------------------------------------------------------------------
  110-  124 (26.77/20.64)	DLKPANILVMGEGPE
  148-  162 (28.67/22.64)	DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.27|      16|      17|     282|     297|       4
---------------------------------------------------------------------------
  282-  297 (29.29/19.10)	DPIKRITSEQAMQDPY
  301-  316 (30.98/20.60)	DPLPTSDVFAGCQIPY
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP27771 with CDK8 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) PKREFLTEEEPDDKGDKTIEKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSTTSQQPPQYSHQTHRY
317
430

Molecular Recognition Features

MoRF SequenceStartStop
NANANA