<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27771
| Description |
Cyclin dependent kinase 8 |
| Sequence | HRKDDKDYALKQIEGTGISMSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKPVQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIGKFAICCLFQSTLLVFKHSYHTGKSEFDLKRTFSHLSLHCLCSLFSLFPFSINKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKHKVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLTEEEPDDKGDKTIEKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSTTSQQPPQYSHQTHRY |
| Length | 430 |
| Position | Kinase |
| Organism | Meleagris gallopavo (Wild turkey) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Phasianidae>
Meleagridinae> Meleagris.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.596 |
| Instability index | 45.11 |
| Isoelectric point | 9.23 |
| Molecular weight | 49272.88 |
| Publications | PubMed=20838655
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
nucleolus GO:0005730 IEA:Ensembl
|
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:Ensembl
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP27771
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.35| 14| 16| 190| 203| 1
---------------------------------------------------------------------------
190- 203 (27.55/16.21) FKH.SYHTGKSEFDL
207- 221 (23.80/13.14) FSHlSLHCLCSLFSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.44| 15| 35| 110| 124| 2
---------------------------------------------------------------------------
110- 124 (26.77/20.64) DLKPANILVMGEGPE
148- 162 (28.67/22.64) DLDPVVVTFWYRAPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.27| 16| 17| 282| 297| 4
---------------------------------------------------------------------------
282- 297 (29.29/19.10) DPIKRITSEQAMQDPY
301- 316 (30.98/20.60) DPLPTSDVFAGCQIPY
---------------------------------------------------------------------------
|