<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27749
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | XAAAISSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADANFDTLMVKLKGFFQNAKANKIESRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYCPCVIANDCWNLLMEFMQSFMGSHTPSIPSVFGTKHDSIYSPADTMVQYMELFNKIRKQQQVPVAGIR |
| Length | 164 |
| Position | Head |
| Organism | Meleagris gallopavo (Wild turkey) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Phasianidae>
Meleagridinae> Meleagris.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.029 |
| Instability index | 38.05 |
| Isoelectric point | 7.78 |
| Molecular weight | 18161.82 |
| Publications | PubMed=20838655
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27749
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 134.70| 38| 60| 32| 70| 1
---------------------------------------------------------------------------
32- 70 (63.06/45.54) ENGPCLIADANFDTLMVKLKGFFqNAKANKIES.RGTRYQ
95- 133 (71.63/47.29) EYCPCVIANDCWNLLMEFMQSFM.GSHTPSIPSvFGTKHD
---------------------------------------------------------------------------
|