<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27744
| Description |
Transcription elongation factor A3 |
| Sequence | MGPAEELVRIAKKLDKMVARKSTEGALDLLKSLTGYTMTIQLLQTTRIGVAVNSVRKHCSDEEVVASAKILIKNWKRLLESSAPPKKEKDTDGEKEKKEKEKRLDVPSPNEGANPHPAKHPKNPTEKHREKHKERRDSADSRSSATSSSSSPQKRPSGERANSSKGKAETPRTPSSPSFSPSICLLPPCYLTGDSVRDKCVEMLTAALRMDGEWDGMVRGVWPQRLAPHIFQELKSTDMKYRNRVRSRISNLKDPKNPNLRRNVLCGAIAPALIARMTAEEMASDELKELRNAMTQEAIREHQMAKTGGTVTDLFQCGKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKFC |
| Length | 355 |
| Position | Unknown |
| Organism | Meleagris gallopavo (Wild turkey) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Galloanserae> Galliformes> Phasianidae>
Meleagridinae> Meleagris.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.840 |
| Instability index | 48.91 |
| Isoelectric point | 9.53 |
| Molecular weight | 39747.13 |
| Publications | PubMed=20838655
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27744
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.19| 24| 30| 80| 105| 1
---------------------------------------------------------------------------
80- 103 (41.20/22.00) ESSAP.PKKEKDTDGEKEK.KEKEKR
111- 136 (36.98/14.09) EGANPhPAKHPKNPTEKHReKHKERR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.19| 21| 23| 137| 157| 3
---------------------------------------------------------------------------
137- 157 (34.94/15.88) DSADSRSSATSSSSSPQKRPS
162- 182 (37.25/17.32) NSSKGKAETPRTPSSPSFSPS
---------------------------------------------------------------------------
|