| Description | Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | RRSPWRGARVAMATYSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQGGXXXXTASVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYTRLKLSDVARTCEQMLEN |
| Length | 130 |
| Position | Head |
| Organism | Ailuropoda melanoleuca (Giant panda) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Carnivora> Caniformia> Ursidae> Ailuropoda. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.610 |
| Instability index | 37.51 |
| Isoelectric point | 8.68 |
| Molecular weight | 14205.90 |
| Publications | PubMed=20010809 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP27743
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 31.19| 10| 31| 19| 33| 1
---------------------------------------------------------------------------
19- 33 (12.20/16.92) NERLraledIEREIG
52- 61 (18.99/10.36) NERL.....LDRQGG
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) IFGRY 2) WLHKIVPPSRWRKRAVKF | 2148 2091 | 2152 2108 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab