<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27739
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | TMENFSALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAQPPTAATAPPGADKSAAGCGPFYLMRELPGSTELTGSTNLITHYNLEHSYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGVGSSQASSSSSLR |
| Length | 245 |
| Position | Head |
| Organism | Ailuropoda melanoleuca (Giant panda) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Ursidae> Ailuropoda.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.024 |
| Instability index | 62.49 |
| Isoelectric point | 9.83 |
| Molecular weight | 26377.81 |
| Publications | PubMed=20010809
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27739
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.37| 16| 16| 15| 30| 1
---------------------------------------------------------------------------
15- 30 (37.08/10.59) PPPPPTALGFGPGKPP
32- 47 (38.29/11.14) PPPPPPGGGPGTAQPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.91| 16| 17| 191| 206| 2
---------------------------------------------------------------------------
171- 184 (25.73/ 9.99) P..PKKKNKHKHKQSR
191- 206 (27.40/11.02) PETPSDSDHKKKKKKK
210- 225 (26.77/10.63) PERKRKKKEKKKKKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 131.62| 40| 46| 69| 114| 3
---------------------------------------------------------------------------
69- 112 (68.72/45.05) MRELPGSTELTGSTNLITHYN.LEHSYNKFCGkkvkEKLSNF......LPD
116- 162 (62.90/28.97) MIDLPGSHDNSSLRSLIEKPPiLGGSFNPITG....TMLAGFrlhtgpLPE
---------------------------------------------------------------------------
|