<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27738

Description Mediator complex subunit 25
SequenceMVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHRVCLLICNSPPYLLPAVESTTYSGYTTESLVQKIGEQGIHFSIVSPRKLPALRLLFEKAAPPALLEPLQPPTDVSQDPRHMVLVRGLVLPVGGGSAPGPLQPKQPVPLPPAPPSGASLSAAPQQPLPPVPQQYQVPGNLSAAQVAAQNAVEAAKNQKAGLGPRFSPINPLQQAAPGVGPPFSQAPAPPLPPGPPGAPKAPPASQPSLVSTVAPGPGLAPPAQPGAPSMAGTVAPGGVSGPSPAQLGAPALGGQQSVSNKLLAWSGVLEWQEKPKPASVDANTKLTRSLPCQVYVNHGENLKTEQWPQKLIMQLIPQQLLTTLGPLFRNSRMVQFHFTNKDLESLKGLYRIMGNGFAGCVHFPHTAPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITNHKQVQQQKLEQQRGMGAQQAPPGLGPILEDQARPSQNLLQLRPPQPQPQGTVGASAASGQPQPQGAAQAPPGAPQGPPGAAPGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWTTQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI
Length746
PositionUnknown
OrganismAiluropoda melanoleuca (Giant panda)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Carnivora> Caniformia> Ursidae> Ailuropoda.
Aromaticity0.05
Grand average of hydropathy-0.242
Instability index59.97
Isoelectric point8.64
Molecular weight78047.73
Publications
PubMed=20010809

Function

Annotated function 
GO - Cellular Component
nucleoplasm	GO:0005654	IEA:Ensembl

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP27738
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     166.60|      26|      26|     311|     336|       1
---------------------------------------------------------------------------
  234-  252 (38.38/ 7.17)	SA....PGP..LQP....KQPV.PL.PPAP...P
  311-  333 (48.39/11.25)	...QAAPGV..GPPF..SQAPAPPL.PPGP...P
  334-  362 (36.71/ 6.49)	GAPKAPPAS..QPSLvsTVAPGPGLaPPAQ...P
  608-  636 (43.12/ 9.10)	GAAQAPPGApqGPPG..A.APGPP..PPGPilrP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     139.39|      27|      44|     640|     666|       4
---------------------------------------------------------------------------
  258-  280 (40.36/10.37)	S.AAPQ..QP.L.PPVPQ..QYQVPGNLSA
  640-  666 (53.43/16.32)	G.ANPQLRSLLLNPPPPQ..TGVPPPQASL
  684-  713 (45.60/12.76)	GlGQPQLGPPLLHPPPAQswTTQLPPRAPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      97.27|      30|     110|      39|      69|       5
---------------------------------------------------------------------------
   39-   69 (53.43/31.17)	YLLPAIEYFN.GGPPAETdFGGDYG..GTQYSLV
  151-  183 (43.84/21.00)	YLLPAVESTTySGYTTES.LVQKIGeqGIHFSIV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     103.05|      26|      26|     471|     496|       6
---------------------------------------------------------------------------
  471-  496 (46.99/34.79)	VQF.HFTNKDLESLKGLYRIMGNGFAG
  498-  524 (34.64/23.55)	VHFpHTAPCEVRVLMLLYSSKKKIFMG
  547-  563 (21.42/11.52)	VQ.....QQKLEQQRG....MGAQQA.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      92.60|      25|     284|     428|     453|       8
---------------------------------------------------------------------------
  402-  423 (32.11/17.60)	...WSGVLEWQEKPKPASVDANTKL
  424-  439 (28.18/11.21)	TRS.........LPCQVYVNHGENL
  441-  462 (32.31/19.36)	TEQWPQKLIMQLIPQQLLTTLG...
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27738 with Med25 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) GGSAPGPLQPKQPVPLPPAPPSGASLSAAPQQPLPPVPQQYQVPGNLSAAQVAAQNAVEAAKNQKAGLGPRFSPINPLQQAAPGVGPPFSQAPAPPLPPGPPGAPKAPPASQPSLVSTVAPGPGLAPPAQPGAPSMAGTVAPGGVSGPSPAQLGAPALG
2) HKQVQQQKLEQQRGMGAQQAPPGLGPILEDQARPSQNLLQLRPPQPQPQGTVGASAASGQPQPQGAAQAPPGAPQGPPGAAPGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWTTQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMD
232
544
390
744










Molecular Recognition Features






MoRF SequenceStartStop




NANANA