<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27732
| Description |
Mediator complex subunit 22 |
| Sequence | MAQQRALPQSKETLLQSYNKRLKDDVKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRALQEECDRKLIALRDEISIDLYELEEEYYSSRWRKSSSLCEAHDLPLCEAYWRLDLDTDSADGLSAPVLASPEPTTGPMQAAVPAHSHASGPGPSEHT |
| Length | 204 |
| Position | Head |
| Organism | Ailuropoda melanoleuca (Giant panda) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Ursidae> Ailuropoda.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.633 |
| Instability index | 61.03 |
| Isoelectric point | 4.80 |
| Molecular weight | 23019.45 |
| Publications | PubMed=20010809
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27732
No repeats found
No repeats found
|