<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27728
Description |
Mediator complex subunit 30 |
Sequence | MSTPPLAASGMAPGPFGGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQPDKLPNGVTYHTGTYQDRLAKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
Length | 181 |
Position | Head |
Organism | Ailuropoda melanoleuca (Giant panda) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Carnivora> Caniformia> Ursidae> Ailuropoda.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.643 |
Instability index | 45.04 |
Isoelectric point | 8.44 |
Molecular weight | 20610.41 |
Publications | PubMed=20010809
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP27728
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.58| 21| 69| 80| 100| 2
---------------------------------------------------------------------------
80- 100 (35.66/24.22) KLQDHLRQLSILFRKLR.LVYD
151- 172 (32.91/21.90) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|