<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27721
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | AREAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKYLLYWKEPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQHSNAAGK |
Length | 131 |
Position | Middle |
Organism | Ailuropoda melanoleuca (Giant panda) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.15 |
Grand average of hydropathy | -0.671 |
Instability index | 31.05 |
Isoelectric point | 8.73 |
Molecular weight | 15837.96 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP27721
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 106.11| 35| 44| 22| 65| 1
---------------------------------------------------------------------------
22- 63 (48.15/49.73) LEFVQCLanpNYLNFLaQRGYFKdKAFVN.....YL..KYLLYWKEpeY
67- 108 (57.96/29.22) LKYPQCL...HMLELL.QYEHFR.KELVNaqcakFIdeQQILHWQH..Y
---------------------------------------------------------------------------
|