Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MMENFSALFGASEPPPPVAAAALGFGPGKPGGPVTGPSPVPAVAPIGEEAARKAAASSGPFYLMRELPGTTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPICGSSFNPITGTMLTGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEDDPERKRKKKEKKKKKNRHSPEHPGVGSSQASSSSSLR |
Length | 240 |
Position | Head |
Organism | Anolis carolinensis (Green anole) (American chameleon) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Lepidosauria> Squamata> Bifurcata> Unidentata> Episquamata> Toxicofera> Iguania> Dactyloidae> Anolis. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.879 |
Instability index | 63.29 |
Isoelectric point | 9.83 |
Molecular weight | 26001.51 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro transcription factor binding GO:0008134 IBA:GO_Central |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP27700 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 77.31| 22| 39| 167| 189| 1 --------------------------------------------------------------------------- 167- 189 (37.44/24.18) PKKKNKHKHKQSRtQDPVPPETP 205- 226 (39.87/21.53) PERKRKKKEKKKK.KNRHSPEHP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 25.63| 6| 111| 16| 41| 2 --------------------------------------------------------------------------- 9- 14 (12.08/ 7.59) FGASEP 25- 30 (13.56/10.73) FGPGKP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 40.48| 11| 38| 63| 73| 4 --------------------------------------------------------------------------- 63- 73 (19.51/10.31) LMRELPGTTEL 104- 114 (20.97/11.55) FLPDLPGMIDL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MMENF 2) SDHKKKKKKKEDDPERKRKKKEKKKKKNRHSPEH | 1 192 | 5 225 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab