<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27700
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MMENFSALFGASEPPPPVAAAALGFGPGKPGGPVTGPSPVPAVAPIGEEAARKAAASSGPFYLMRELPGTTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPICGSSFNPITGTMLTGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEDDPERKRKKKEKKKKKNRHSPEHPGVGSSQASSSSSLR |
| Length | 240 |
| Position | Head |
| Organism | Anolis carolinensis (Green anole) (American chameleon) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Lepidosauria> Squamata> Bifurcata> Unidentata> Episquamata> Toxicofera>
Iguania> Dactyloidae> Anolis.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.879 |
| Instability index | 63.29 |
| Isoelectric point | 9.83 |
| Molecular weight | 26001.51 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP27700
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.31| 22| 39| 167| 189| 1
---------------------------------------------------------------------------
167- 189 (37.44/24.18) PKKKNKHKHKQSRtQDPVPPETP
205- 226 (39.87/21.53) PERKRKKKEKKKK.KNRHSPEHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 25.63| 6| 111| 16| 41| 2
---------------------------------------------------------------------------
9- 14 (12.08/ 7.59) FGASEP
25- 30 (13.56/10.73) FGPGKP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.48| 11| 38| 63| 73| 4
---------------------------------------------------------------------------
63- 73 (19.51/10.31) LMRELPGTTEL
104- 114 (20.97/11.55) FLPDLPGMIDL
---------------------------------------------------------------------------
|