<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27698
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MGVTCVSQMPIAEGKSVQQTVEILTRKLELLGAEKQGTFYVDCKTYHTAAATMGNTHQGQTAKLMYVMHNSEYPLSCFSLFENGPCLKSDANCDVLMVKLKGFFQNTKGNKIESQGTRYQYCDFLVKVGTVTIGPSVLGISVEAEYCPCVVANDCWNLLMEFMQSFMGSHAPGIPSVFGNKHDSIYSPGDMMVQYMELFNQIRKQQQVPTAGIR |
| Length | 214 |
| Position | Head |
| Organism | Anolis carolinensis (Green anole) (American chameleon) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Lepidosauria> Squamata> Bifurcata> Unidentata> Episquamata> Toxicofera>
Iguania> Dactyloidae> Anolis.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.113 |
| Instability index | 35.97 |
| Isoelectric point | 6.50 |
| Molecular weight | 23730.16 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP27698
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 113.63| 32| 60| 82| 114| 1
---------------------------------------------------------------------------
82- 114 (52.27/31.54) ENGPCLKSDaNCDVLMVKLKGFFQNTKGNKIES
145- 176 (61.36/33.57) EYCPCVVAN.DCWNLLMEFMQSFMGSHAPGIPS
---------------------------------------------------------------------------
|