<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27696
| Description |
Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | FSLVSVSQMPIAEGKSVQQTVEILTRKLELLGAEKQGTFCVDCETYHTAASTMGNQGQTAKLMYVMHNSEYPLSCFALFENGPCLIADANFDVLMVKLKGFFQNAKGNKIESRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYCPCVVANDCWNLLMEFMQSFMGSHAPGIPSVFGNKHDSIYSPGDTMVQYMELFNKIRKQQQVPIAGIR |
| Length | 212 |
| Position | Head |
| Organism | Anolis carolinensis (Green anole) (American chameleon) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Lepidosauria> Squamata> Bifurcata> Unidentata> Episquamata> Toxicofera>
Iguania> Dactyloidae> Anolis.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.049 |
| Instability index | 34.32 |
| Isoelectric point | 6.47 |
| Molecular weight | 23528.94 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP27696
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.86| 19| 31| 120| 138| 1
---------------------------------------------------------------------------
120- 138 (34.98/22.25) C.........DFLVKVGTVTMGPSARGI
145- 172 (29.88/18.12) CpcvvandcwNLLMEFMQSFMGSHAPGI
---------------------------------------------------------------------------
|