<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27693
| Description |
Mediator of RNA polymerase II transcription subunit 4 (Fragment) |
| Sequence | PSADMAVPEKSTKERLMSFLDDLEVLSRELIEMLALSRNQKLSQPGEENQILELLIQKDGEFQELMKVALSQGKIHQEMQVLEKEVEKRDSDIQQLQKQLKEAEHILATAVYQAKEKLKSIDKARKGAISSEELIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMSNLPTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSNEFLMESLGPNKENEEDVEVMSTDSSSSSSDSD |
| Length | 256 |
| Position | Middle |
| Organism | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.610 |
| Instability index | 53.10 |
| Isoelectric point | 4.83 |
| Molecular weight | 28510.89 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP27693
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.42| 24| 33| 40| 72| 1
---------------------------------------------------------------------------
41- 67 (35.58/35.60) KLSQpgeENQILELLIQK.DGEFQELMK
74- 98 (36.84/13.17) KIHQ...EMQVLEKEVEKrDSDIQQLQK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.48| 13| 36| 176| 188| 2
---------------------------------------------------------------------------
176- 188 (25.02/13.91) MSNLPTNGVNGHL
215- 227 (26.46/15.04) MNMLPPNHSNEFL
---------------------------------------------------------------------------
|