Description | Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MSLQNESLKKIQSILIPQSIQSVQSTDPTISNEASAGAGSNTQVLSSSSSTSSEFVPHIFYSLYQIKKDPSSSTNQLETATGFIRHRLKNCKSLIENNNDCKKLLSKSAEDWESYLQNAELEIQGKRNVLDELKAKINSLSNDKSSQDGAAAQL |
Length | 154 |
Position | Middle |
Organism | Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) (Saccharomyces dairenensis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Naumovozyma. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.612 |
Instability index | 54.20 |
Isoelectric point | 6.11 |
Molecular weight | 16867.52 |
Publications | PubMed=22123960 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364145 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi cytosol GO:0005829 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | structural molecule activity GO:0005198 IEA:EnsemblFungi transcription coactivator activity GO:0003713 IEA:EnsemblFungi |
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP27691 No repeats found |
MoRF Sequence | Start | Stop |
1) IQSILIP 2) STSSEFVPHIFYSLYQIKKDPSSST | 11 50 | 17 74 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab