Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MSGNNEDANAFGSLYPPPPPYIKFFTEENLSKLPEYQKLKKSGTIEEIDANKDTNDDTETITSELDFLIPPEMPRTQQYRAFGNIWQVKDQLPDLGSMGITQLYKTSNEIGGPMNYQYKIEESRKLLKSLLLNYLELIGILSINPELYEKRWKIFELY |
Length | 158 |
Position | Middle |
Organism | Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) (Saccharomyces dairenensis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Naumovozyma. |
Aromaticity | 0.11 |
Grand average of hydropathy | -0.640 |
Instability index | 46.58 |
Isoelectric point | 4.73 |
Molecular weight | 18323.57 |
Publications | PubMed=22123960 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP27682 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) EYQKLKK 2) PYIKFFTE | 35 20 | 41 27 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab