| Description | Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSGNNEDANAFGSLYPPPPPYIKFFTEENLSKLPEYQKLKKSGTIEEIDANKDTNDDTETITSELDFLIPPEMPRTQQYRAFGNIWQVKDQLPDLGSMGITQLYKTSNEIGGPMNYQYKIEESRKLLKSLLLNYLELIGILSINPELYEKRWKIFELY |
| Length | 158 |
| Position | Middle |
| Organism | Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) (Saccharomyces dairenensis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Naumovozyma. |
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.640 |
| Instability index | 46.58 |
| Isoelectric point | 4.73 |
| Molecular weight | 18323.57 |
| Publications | PubMed=22123960 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
| Binary Interactions |
| Repeats | >MDP27682 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) EYQKLKK 2) PYIKFFTE | 35 20 | 41 27 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab