Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSTFTETANASSNVEQILPSYYYYVDPEVSYQPQIPNPLDDLISIYGLDDLSRQVARSNTETGIKAVKLRKSYKNQISDLSGKFTTIPTRENGKGGEISHILFQNNPDMMNQIHRNTSKNDNEWIEHARNRDMDLFQSTKNMDWNVCNNVISQFEKSYPSEFQQQQFNVDDLAFDLDGTGKNNGNIPGSVGNNKKRKNKSNGSSMATPNSDVQQEDLKRRRLE |
Length | 223 |
Position | Head |
Organism | Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) (Saccharomyces dairenensis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Naumovozyma. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.999 |
Instability index | 45.99 |
Isoelectric point | 5.71 |
Molecular weight | 25425.70 |
Publications | PubMed=22123960 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblFungi |
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi transcription open complex formation at RNA polymerase II promoter GO:0001113 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP27678 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 67.80| 20| 41| 130| 149| 3 --------------------------------------------------------------------------- 130- 149 (40.71/25.44) NRD...MDLFQSTK...NMDWNVCNN 168- 193 (27.09/14.88) NVDdlaFDLDGTGKnngNIPGSVGNN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FNVDD 2) KKRKNKS 3) MATPNSDVQQEDLKRRRLE 4) PLDDLISIY 5) QILPSYYYYVDPEVSYQ | 167 194 205 38 16 | 171 200 223 46 32 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab