<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27677
Description |
Uncharacterized protein |
Sequence | MNNQALFEKLDQTVELLSLKLAELIRLSSIDNPESANDNIDSGSMNSGMLEAQDSNIAIATTSMTMVYGQTMQLIRGVQDLLVMTRGMREMWLLNQIPDQDKQNDNARSINHEELASLLNTCMQEIIGEPPSL |
Length | 133 |
Position | Head |
Organism | Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) (Saccharomyces dairenensis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Naumovozyma.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.282 |
Instability index | 35.62 |
Isoelectric point | 4.23 |
Molecular weight | 14826.69 |
Publications | PubMed=22123960
|
Function
Annotated function |
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP27677
No repeats found
No repeats found
|